PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00332g07018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TCP
Protein Properties Length: 99aa    MW: 11308.7 Da    PI: 10.4872
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00332g07018.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP55.42.5e-176095237
                       TCP  2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqd 37
                              a+k+++++++hTkv+gR+RR+R++a+caar+F+L++
  Niben101Scf00332g07018.1 60 APKRSSNKDRHTKVEGRGRRIRMPALCAARIFQLTR 95
                              789********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.3E-126595IPR005333Transcription factor, TCP
PROSITE profilePS5136914.6676699IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 99 aa     Download sequence    Send to blast
MDPKGSKQPQ EEISNFLSHP NPKNINTNIS SNMGENNLVE INDFQIENSD KDETKKQQLA  60
PKRSSNKDRH TKVEGRGRRI RMPALCAARI FQLTRFSNA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009757310.11e-57PREDICTED: transcription factor TCP20 isoform X2
SwissprotQ9LSD56e-24TCP20_ARATH; Transcription factor TCP20
TrEMBLA0A0D2TKZ16e-39A0A0D2TKZ1_G
STRINGVIT_14s0068g01690.t012e-37(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.13e-25TCP family protein